General Information

  • ID:  hor005350
  • Uniprot ID:  Q3SAE6
  • Protein name:  Natriuretic peptide HsNP-a
  • Gene name:  NA
  • Organism:  Hoplocephalus stephensii (Stephens' banded snake)
  • Family:  natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hoplocephalus (genus), Notechinae (subfamily), Elapidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGSKTAKIGDGCFGVRLDRIGSTSGMGCGGVPKP
  • Length:  34(1-34)
  • Propeptide:  SGSKTAKIGDGCFGVRLDRIGSTSGMGCGGVPKPTPGGS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3) (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  46019
  • Structure ID:  AF-Q3SAE6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005350_AF2.pdbhor005350_ESM.pdb

Physical Information

Mass: 388558 Formula: C137H231N43O45S3
Absent amino acids: EHNQWY Common amino acids: G
pI: 9.66 Basic residues: 5
Polar residues: 17 Hydrophobic residues: 7
Hydrophobicity: -18.82 Boman Index: -4167
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 54.41
Instability Index: 1206.76 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.79

Literature

  • PubMed ID:  16908092
  • Title:  Cloning and characterisation of natriuretic peptides from the venom glands of Australian elapids.